LL-37 (37-1) trifluoroacetate salt

H-Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe-Asp-Gly-Leu-Leu-OH trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-901	0.5mg	160.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	2022972-70-7
Sequence	SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Synonyms	Cationic Antimicrobial Protein 18 (170-134) (human), hCAP-18 (170-134)
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document